Whois altamodaspa.net

Whois: altamodaspa.net
Popularity & Rank History


Traffic Coming from Search Engines

Info database by Alexa Rank for whois.

Description of altamodaspa.net

Title:
altamodaspa.net

Tags:
your, site

DNS server information for altamodaspa.net

  • Domain name: altamodaspa.net
  • DNS main server: ns.olivewebhosting.com
  • DNS admin contact: admin[at]olivewebhosting.com
  • DNS serial: 2015122505
  • DNS refresh: 01 days 03:00:00
  • DNS retry: 01 days 01:00:00
  • DNS expire: 08 days 00:00:00
  • DNS minimum ttl: 02 days 00:00:00
  • DNS ttl: 02 days 00:00:00
  • IP assigned to altamodaspa.net: 109.203.99.210
  • Name server: ns.olivewebhosting.com
  • Name server: ns2.olivewebhosting.com
  • Mail server: mail.olivewebhosting.com
  • Mail server: mail2.olivewebhosting.com


Embed:

Domain thumbnails

eselfontein.com thumbnail sgdoaofpa.net thumbnail theaffineur.com thumbnail malibook.net thumbnail connectedtraders.com thumbnail outsourcedmarketingsolutions.com thumbnail pulseindia.net thumbnail mbenji.net thumbnail bridalweather.com thumbnail waitsfieldchamplainvalleytelecom.net thumbnail

Domains locations

whois
IR35 private sector reforms: Bank of America IT contractors await verdict on future employment terms

IR35 private sector reforms: Blanket bans ‘devalue’ IT contractor contributions to digital projects

Aeris gears up for connected vehicle joint venture with VW

IR35 private sector reforms: Recruitment industry urges chancellor to halt April 2020 roll-out

Milan hosts Cisco’s first European security innovation unit

Check other our website:
Adult domain lookup